PyTorch implementation of a modified (style-based) AttnGAN [code] architecture that incorporates the strong latent space control provided by StyleGAN*. This architecture enables one to not only synthesize an image from an input text description, but also move that image in a desired disentangled dimension to alter its structure at different scales (from high-level coarse styles such as pose to fine-grained styles such as background lighting).
GIF OF LATENT SPACE INTERPOLATION EXAMPLE COMING SOON
This implementation also provides one with the option to utilize state-of-the-art transformer-based architectures from huggingface's transformers library as the text encoder for Style-AttnGAN (currently only supports GPT-2). Among other things, utilization of these transformer-based encoders significantly improves image synthesis when the length of the input text sequence is large.
Original AttnGAN paper: AttnGAN: Fine-Grained Text to Image Generation with Attentional Generative Adversarial Networks by Tao Xu, Pengchuan Zhang, Qiuyuan Huang, Han Zhang, Zhe Gan, Xiaolei Huang, Xiaodong He. (This work was performed when Tao was an intern with Microsoft Research). Thank you for your brilliant work.
AttnGAN architecture from arxiv.org/abs/1711.10485 StyleGAN generator architecture from arxiv.org/abs/1812.04948
Copyright for portions of project Style-AttnGAN are held by Tao Xu, 2018 as part of project AttnGAN. All other copyright for project Style-AttnGAN are held by Sidhartha Parhi, 2020. All non-data files that have not been modified by Sidhartha Parhi include the copyright notice "Copyright (c) 2018 Tao Xu" at the top of the file.
Dependencies
python 3.7+
PyTorch 1.0+
In addition, please add the project folder to PYTHONPATH and pip install the following packages (or go pip install -r requirements.txt):
python-dateutileasydictpandastorchfilenltkscikit-imagepyyamltqdmpytorch-fidlpipstransformersgan-lab
Data
- Download preprocessed data from taoxugit for birds coco and save them to `data/
- Unzip
data/birds/text.zipand/ordata/coco/train2014-text.zip&data/coco/val2014-text.zip - Download the birds image data. Extract them to
data/birds/ - Download coco dataset and extract the images to
data/coco/
Training
-
Pre-train DAMSM models:
- For bird dataset:
python pretrain_DAMSM.py --cfg cfg/DAMSM/bird.yml --gpu 0 - For coco dataset:
python pretrain_DAMSM.py --cfg cfg/DAMSM/coco.yml --gpu 0
- For bird dataset:
-
Train Style-AttnGAN models:
- For bird dataset:
python main.py --cfg cfg/bird_attn2_style.yml --gpu 0 - For coco dataset:
python main.py --cfg cfg/coco_attn2_style.yml --gpu 0
- For bird dataset:
-
Train original AttnGAN models:
- For bird dataset:
python main.py --cfg cfg/bird_attn2.yml --gpu 0 - For coco dataset:
python main.py --cfg cfg/coco_attn2.yml --gpu 0
- For bird dataset:
-
*.ymlfiles are example configuration files for training/evaluation models. -
After pretraining DAMSM, save best text & image encoders into
DAMSMencoders/and specify the text encoder path in NET_E in the appropriate Style-AttnGAN yaml or in code/miscc/config.py. Alternatrively, skip this step by downloading appropriate DAMSM in the "Pretrained Model" section below. -
User can also optionally set the
--text_encoder_typeflag totransformerto use GPT-2 as the text encoder (more text encoder options coming soon). If doing so, user must pre-train the DAMSM (see instruction above).
Pretrained Model
-
DAMSM for bird. Download and save it to
DAMSMencoders/. Text encoder here is BiLSTM. -
DAMSM for coco. Download and save it to
DAMSMencoders/. Text encoder here is BiLSTM. -
Style-AttnGAN for bird. Download and save it to
models/ -
Style-AttnGAN for coco. Download and save it to
models/- COMING SOON
-
Original AttnGAN for bird. Download and save it to
models/ -
Original AttnGAN for coco. Download and save it to
models/ -
AttnDCGAN for bird. Download and save it to
models/- This is an variant of AttnGAN which applies the propsoed attention mechanisms to DCGAN framework.
Sampling
- Run
python main.py --cfg cfg/eval_bird_style.yml --gpu 0to generate examples from captions in files listed in "./data/birds/example_filenames.txt". Results are saved inmodels/. - Change the
eval_*.ymlfiles to generate images from other pre-trained models. - Input your own sentence in "./data/birds/example_captions.txt" if you wannt to generate images from customized sentences.
Validation
- To generate images for all captions in the validation dataset, change B_VALIDATION to True in the eval_*.yml file, and then run
python main.py --cfg cfg/eval_bird_style.yml --gpu 0 - Metrics can be computed based on the validation set. Set the corresponding booleans to True in the eval_*.yml file in order to do so.
- The following metrics can be computed with this Style-AttnGAN repo directly:
I. PPL:
Perceptual Path Length. A measure of linear interpolability of the latent space.
Derived from LPIPS. The lower the better. A lower score is an indication that one
can more easily tune the latent code to generate the exact image he/she desires.
II. FID:
Fréchet Inception Distance. A measure of generated image quality.
Proposed as an improvement over the Inception Score (IS). The lower the better.
III. R-precision:
A measure of visual-semantic similarity between generated images and
their corresponding text description. Expressed as a percentage.
CLEANED UP IMPLEMENTATION COMING SOON - To compute Inception Score (IS), use this repo for the birds dataset and this repo for the COCO dataset.
- The following metrics can be computed with this Style-AttnGAN repo directly:
Below are instructions for setting up and training & testing with your own dataset. I use the dataset barebones_birds as an example custom dataset.
Data
-
I've included a bare-bones version of the birds dataset above (download link: barebones_birds). Extract it into
data/. Then, go intodata/barebones_birdsand extracttext.zipintotext/andimages.zipintoimages/.- This dataset consists of only images and captions for those images. Use this as an example on how to set up your own custom single-class dataset for training and inference.
- Note that this dataset uses jpg. If you want to use some other extension (e.g. png) instead, you need to specify the extension in EXT_IN and EXT_OUT in the 3 YAML files discussed below.
Training
-
Pre-train DAMSM:
- For your own custom dataset, you will have to pre-train the DAMSM for it. To do so, first you will have to set up the YAML file for it. See
code/cfg/DAMSM/barebones_bird.ymlfor an example on how to set that up. - Run
python pretrain_DAMSM.py --cfg cfg/DAMSM/barebones_bird.yml --gpu 0 - After pretraining DAMSM, save best text & image encoders into
DAMSMencoders/
- For your own custom dataset, you will have to pre-train the DAMSM for it. To do so, first you will have to set up the YAML file for it. See
-
Train Style-AttnGAN
- Set up the YAML file for Style-AttnGAN training. See
code/cfg/barebones_bird_attn2_style.ymlfor an example on how to set that up. Make sure to specify the path to the best text encoder you put inDAMSMencoders/for NET_E. - Run
python main.py --cfg cfg/barebones_bird_attn2_style.yml --gpu 0 - The Style-AttnGAN training above will periodicially save your models
- Set up the YAML file for Style-AttnGAN training. See
Inference
- Set up the YAML file for Style-AttnGAN inference. See
code/cfg/eval_barebones_bird_style.ymlfor an example on how to set that up. Make sure to se that same path for NET_E that you used above for barebones_bird_attn2_style.yml, and specify the path to the best Style-AttnGAN for NET_G. - After that, follow the instructions in the section above for Sampling and / or Validation, except instead of using evals_bird_style.yml, use eval_barebones_bird_style.yml.
Examples generated by Style-AttnGAN vs AttnGAN for input text:
I have visually inspected a few hundred generated images from both Style-AttnGAN and AttnGAN. My human judgement is that the Style-AttnGAN images are more photo-realistic and are much more consistent than the AttnGAN images. I plan to test out Style-AttnGAN with other datasets and compare to the SOTA in the near future.
Examples of latent space interpolation with Style-AttnGAN
- GIF COMING SOON
Examples of style-mixing with Style-AttnGAN
- COMING SOON
Comparisons with MirrorGAN and DM-GAN
- COMING SOON
Notes about the table in general: The arrows next to each metric title indicate whether lower is better or higher is better. Official reports of scores are used wherever possible; otherwise scores are computed using this repo. "(-)" indicates that the value hasn't been computed/recorded yet; these will be updated soon.
Note about FID: It has been mentioned that the PyTorch implementation of FID produces different scores than the Tensorflow implementation of FID. Also, even though the quantitative quality metrics in the table below (i.e. FID and IS) for Style-AttnGAN seem to be on the lower end relative to the SOTA, visual inspection of these generated images tells a different story. Upon visual inspection of a few hundred generated images, the Style-AttnGAN generated images look more photo-realistic and are much more consistent than the AttnGAN generated images. See the qualitative comparison above for some examples of this.
Note about PPL: The PPL (Perceptual Path Length) implementation in Style-AttnGAN aims to replicate the PPL implementation in the official StyleGAN repo. To get a sense of good vs bad scores, please look at the README for this official StyleGAN repo and/or going through the StyleGAN paper. Note that for some of these text-to-image generation architectures (e.g. AttnGAN), it is difficult (and probably not possible) to obtain a measure of linear interpolability of the latent space using the PPL metric due to how the text embedding and the noise are mixed together and learned. Nevertheless, my qualitative experiments clearly show the advantage of Style-AttnGAN over AttnGAN in terms of linear interpolation of the latent space. I will put examples of these qualitative experiments in this README soon.
| Model | PPL↓ | R-precision↑ | IS↑ | PyTorch FID↓ | TF FID↓ |
|---|---|---|---|---|---|
| Style-AttnGAN | 493.7656 | (-) | 4.33 ± 0.09 | 25.60 | (-) |
| AttnGAN | (-) | 67.82% ± 4.43% | 4.36 ± 0.03 | 23.98 | 14.01 |
| MirrorGAN | (-) | 60.42% ± (-) | 4.56 ± 0.05 | (-) | (-) |
| DM-GAN | (-) | 72.31% ± 0.91% | 4.75 ± 0.07 | 16.09 | (-) |
Evaluation code embedded into a callable containerized API is included in the eval\ folder.
If you find the original AttnGAN useful in your research, please consider citing:
@article{Tao18attngan,
author = {Tao Xu, Pengchuan Zhang, Qiuyuan Huang, Han Zhang, Zhe Gan, Xiaolei Huang, Xiaodong He},
title = {AttnGAN: Fine-Grained Text to Image Generation with Attentional Generative Adversarial Networks},
Year = {2018},
booktitle = {{CVPR}}
}
Reference
- AttnGAN: Fine-Grained Text to Image Generation with Attentional Generative Adversarial Networks [code]
- StackGAN++: Realistic Image Synthesis with Stacked Generative Adversarial Networks [code]
- Unsupervised Representation Learning with Deep Convolutional Generative Adversarial Networks [code]
- Add link to downloading pretrained Style-AttnGAN models
- Provide examples for latent space control (GIF) and style-mixing
- Complete the Table of quantitative performance comparisons
- Qualitative comparisons with MirrorGAN and DM-GAN
- Implement easier API functionality for latent space control
- Implement improvements from StyleGAN2
- Analysis with COCO dataset
- Implement more options for SOTA transformer architectures as the text encoder (currently only supports GPT-2)
- Deploy as an interactive web app that makes it easy to control the specific image one wants to generate
*Improvements from StyleGAN2 coming soon










